PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_40072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GATA
Protein Properties Length: 100aa    MW: 11189.8 Da    PI: 10.9791
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_40072genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.71.3e-172963135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                Cs+C +  Tp+WR gp g+ktLCnaCG+++++ +l
  PEQU_40072 29 CSHCLSHRTPQWRAGPLGPKTLCNACGVRFKSGRL 63
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.4E-142373IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.0022359IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.95E-152587No hitNo description
Gene3DG3DSA:3.30.50.104.9E-142764IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.06E-112875No hitNo description
PROSITE patternPS0034402954IPR000679Zinc finger, GATA-type
PfamPF003201.9E-152963IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MEKLDKHQGK ANNGNGNGGE LHPLQPRRCS HCLSHRTPQW RAGPLGPKTL CNACGVRFKS  60
GRLHPEYRPA KSPTFVSYKH SNSHKKVMEM RMAVLSSNSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389002.18e-47PREDICTED: GATA transcription factor 12-like
SwissprotO497412e-35GATA2_ARATH; GATA transcription factor 2
TrEMBLM0S7G47e-47M0S7G4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P12730_0012e-46(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-36GATA transcription factor 4